Lurch

lurch

Word Type
v. i.
lurch Meaning Definition
To swallow or eat greedily; to devour; hence, to swallow up.
Synonyms for lurch
Synonym Search Links for lurch
abandonamblebargebendbentbiasblunderbobbobblebowl alongbumblebundlecapsizecareencareerclumpcogglecome a croppercrookdangledesertdispositiondragdroopdropfallfall downfall flatfall headlongfall overfall prostratefalterflounceflounderfluctuateflutterfootfootslogforsakegaitgallopget a cropperhaltheaveheelhippety-hophitchhobblehobbyhorsehopinclinationjiltjogjoltjumplaborlibratelimplistlock stepluglumberlungemake heavy weathermincemincing stepsnutateoscillatepacepaddlepegpenchantpendulatepiaffepiafferpitchpitch and plungepitch and tossplodplungepoundprancepredilectionpredispositionproclivitypropensityrackrearreelresonaterockrollsashaysaunterscendscuffscufflescuttleseetheshakeshamblesheershufflesidlesingle-footskewskipslinkslitherslogslouchslownesssluesnapsnappersprawlspread-eaglestaggerstalkstammerstampstepstompstraddlestragglestridestrollstrolling gaitstrugglestrutstumblestumpswagswaggerswayswerveswingswingingtake a falltake a floptake a headertake a pratfalltake a spilltendencythrash abouttilttiltertittuptoddletoppletopple downtopple overtosstoss and tumbletoss and turntottertraipsetreadtriptrottrudgetumbleturnturn turtletwisttwitchvacillateveervellicatevelocityvibratevolutationwaddlewagwagglewalkwallopwallowwamblewarpwavewaverweavewelterwhirlwigglewobbleyankyaw

No Items Found.

Add Comment
Type in a Nick Name here
 
Other Items in v. i.
Periphrase Gossip Demur Fabulize Supervene Hebraize Gin Comport Live Exundate Tear Ploy Philosophize Potter Outstart Clinical Drizzle Grabble Surrejoin Miscarry Upgrow Trundle Word Pad Doxologize Dotard Emaciate Animadvert Efflorescent Roost Backbite Seesaw Winch Sleep Thaw Twinge Watch Vie Dotage Dawn Sojourn Beg Pose Baigne Beware Listen Straddle Spoon Fire Consider
Related Search Terms
v. i. v i 13
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote


minecraft
Random CSS Property

@keyframes

The @keyframes CSS at-rule controls the intermediate steps in a CSS animation sequence by defining styles for keyframes (or waypoints) along the animation sequence. This gives more control over the intermediate steps of the animation sequence than transitions.
@keyframes css reference