Confused

confused

Word Type
imp. & p. p.
confused Meaning Definition
of Confuse
Synonyms for confused
Synonym Search Links for confused
Byzantineabashedabroadadriftafflictedagitatedajaraleatoricaleatoryambiguousamorphicamorphousanarchicarsy-varsyass-backwardsastrayat a lossat seabaffledbafflingbaggyballed upballed-upbashfulbefuddledbemusedbesetbewilderedblearblearedblearyblobbyblurredblurrybollixed upbotheredbroadcast downchagrinedchancechancychaoticchapfallencharacterlessclashingcluelesscomplexcomplicatedconflictingconfoundedconfusingconsciouscontradictoryconvolutedcoycrabbeddaedaldarkdazeddemuredeviousdimdisarrangeddiscomfiteddiscomforteddiscomposeddisconcerteddismayeddisordereddisorderlydisorganizeddisorienteddisquieteddistracteddistraughtdistresseddisturbedelaborateembarrassedembrangledentangledfaintfeaturelessfeeblefilmyflusteredflutteredfoggyformlessfouled upfussedfuzzygalley-westgeneralgratingguessinghalf-seenhalf-visibleharshhazyhelter-skelterhiggledy-piggledyhit-or-misshugger-muggerhung upill at easeill-definedimplicatedimprecisein a fixin a jumblein a mazein a messin a picklein a potherin a puckerin a scrapein a stewin a sweatin a swivetin a tizzyinaccurateinarticulateinchoateincoherentinconsistentinconspicuousindecisiveindefinableindefiniteindeterminableindeterminateindistinctindistinguishableinexactinformintricateinvolutedinvolvedjanglingjanglyjarringjostlingjumbledkaleidoscopicknottedlabyrinthianlabyrinthinelaxlooselostloused uplow-profilelumpenmany-facetedmattedmazedmazymeanderingmerely glimpsedmessed upmessymiscellaneousmisleadingmistymixed upmixed-upmortifiedmotleymousymucked upmuddledmultifariousmuzzymystifiedmystifyingnondescriptnonplussednonspecificnot with itobscureoff the trackorderlessout of countenanceout of focusout of itpaleperplexedperplexingperturbedput offput output-output-uponpuzzledpuzzlingramifiedrandomrattledroundaboutruffledscatteredscrewed upself-conscioussemivisibleshadowed forthshadowyshakenshamefacedshamefastshapelessshookshuffledshyskimble-skambleskittishsnafusnarledsnarled upstammeringstochasticsubtlesweepingtangledtanglytimidtimoroustopsy-turvytroubledturned aroundtwisteduncertainunclearuncomfortableundefinedundestinedundetermineduneasyunorderedunorganizedunplainunrecognizableunsettledunspecifiedupsetupside-downvagueveiledwarringweakwithout a clue

No Items Found.

Add Comment
Type in a Nick Name here
 
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote

'Dawnie' used to say, "It's really quite simple: Be kind, and the rest takes care of itself. Never do anything that's not kind".


Dawn Atherton
Random CSS Property

animation-iteration-count

The animation-iteration-count CSS property sets the number of times an animation sequence should be played before stopping.
animation-iteration-count css reference