Bolt

bolt

Word Type
v. t.
bolt Meaning Definition
To refuse to support, as a nomination made by a party to which one has belonged or by a caucus in which one has taken part.
Synonyms for bolt
Synonym Search Links for bolt
AWOLFrench leaveIrish confettiJupiter FulgurThorabscondabsence without leaveabsquatulateabsquatulationapostacizeapostasyapostatizearrowarrowheadarticulateassortattachbackslidingbaleball lightningbangbarbarbbarricadebarrierbattenbatten downbeat a retreatbetraybetrayalbindleblatblockblock upblockadeblowblurt outbobtailed arrowboilbolabolt downbolt of lightningbolt uprightbombbombshellboomerangbouquetbreak awaybreakawaybrickbatbucklebudgetbundleburn outbuttbuttonbutton upcareercatchcategorizechain lightningchange sideschargechasechested arrowchockchokechoke offclapclarifyclaspclassifyclearclear outcleatclipcloseclose offclose tightclose upcloth yard shaftcoilcollateconnectconstrictcontaincontractcordoncordon offcountermissilecovercramcrowdcry outcull outcut and rundark lightningdartdashdash offdebardecampdecampmentdeckdecrassifydefectdefectiondepartdepuratederelictiondesertdeserterdesertiondevourdisappearancedisappearing actdisloyaltydistilldividedogdovetailedulcorateejaculateelopeelopementeluteengorgeerectescapeessentializeexitextracteye-openerfagotfaithlessnessfall awayfall offfardelfascesfascinefastenfilterfiltratefireballfireboltfixfleeflightflingflyflying flamefoldfold upforked lightningfugitatefugitationfulgurationfulminationghettoizegluttonizego AWOLgo overgobblegoing overgorgegormandizegradategradegroupgulpgulp downguttleguzzlehasphastehastenhasty retreathegirahiehingehitchhookhumphump ithurryhurtleingurgitateinsulatejamjointjumpjump bailkeep apartkeep asidekeylashlatchlay asideleachlengthlet downlevantlevin boltlightninglive to eatlixiviatelocklock outlock upmake hastemake offmissilemitermortisenailnosegayoak-cleaving thunderboltsobstructoccludepackpackagepacketpadlockparcelpartpegpercolatepick outpiecepinplumbpoop outportionpostposyprojectilepull outpurifyput asidequarantinequarrelquick exitquiverrabbetracerankratrattingravenrecidivationrecidivismrecreancyrectifyreedrefinerevelationriddlerigidlyrivetrockrocketrodrollrouleaurunrun awayrun away fromrun away withrun for itrun offrun out onrunning awayrushscamperscarfschismscootscourscramscramblescrammingscreenscrewscudscurryscuttlesealseal offseal upsecedesecessionsecludesecuresegregatesell outseparateset apartset asidesewshaftsheafsheet lightningshockshockershootshow the heelsshutshut offshut outshut the doorshut tightshut upsievesiftsizeskedaddleskedaddlingskewerskipskip outslamslip the cableslopsloshsnapsortsort outspiritualizespringsqueezesqueeze shutstaplestartlestep on itstickstifflystiflestitchstonestop upstraightstrainstranglestrangulatestripstroke of lightningstuffsublimatesublimesubordinatesuffocatesurpriseswallow wholeswitchswitch overtacktake French leavetake flighttake to flighttake wingtearthrashthreshthrow stickthrowing-stickthunderballthunderboltthunderstroketoggletorpedotreasontrusstryturn cloakturn tailturning traitorvolleywaddywalkoutwedgewinnowwolfwolf downzip upzipper

No Items Found.

Add Comment
Type in a Nick Name here
 
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote
"We're tight-fisted with property and money, yet think too little of wasting time, the one thing about which we should all be the toughest misers.”
Seneca
Random CSS Property

animation-direction

The animation-direction CSS property sets whether an animation should play forward, backward, or alternate back and forth between playing the sequence forward and backward.
animation-direction css reference