Capricious

capricious

Word Type
a.
capricious Meaning Definition
Governed or characterized by caprice; apt to change suddenly; freakish; whimsical; changeable.
Synonyms for capricious
Synonym Search Links for capricious
adriftafloatagnosticaimlessalternatingambiguousambitendentambivalentamorphousarbitraryat loose endsbrittlebrokencareeningcarelesscasualcatchychancychangeablechangefulchangingchoppycorruptiblecrankycrotchetydeciduousdesultorydeviabledeviatingdeviativedeviatorydiceydifferentdisarticulateddisconnecteddiscontinuousdisjunctdisordereddisorderlydisperseddisproportionatedivaricatedivergentdiversifieddiversiformdizzydouble-mindeddoubtingdubiousdyingeccentriceffervescentephemeralequivocaleroseerraticevanescentfadingfancifulfantasiedfantasticfast and loosefence-sittingfence-straddlingficklefitfulflakyfleetingflickeringflightyflittingfluctuantfluctuatingfly-by-nightflyingformlessfragilefrailfreakishfrivolousfugaciousfugitivegiddygratuitousgutteringhaltinghaphazardharebrainedheedlessherky-jerkyhesitanthesitatingheteroclitehit-or-misshumorsomeiffyimmethodicalimpermanentimpetuousimpulsiveinadvertentincalculableinchoateincoherentinconsiderateinconsistentinconstantindecisiveindemonstrableindiscriminateinfirminfirm of purposeinsubstantialintermittentintermittingirregularirresoluteirresolvedirresponsiblejaggedjerkykinkylubriciouslurchingmaggotymazymeaninglessmercurialmisshapenmomentarymoodymortalmotivelessmotleymugwumpianmugwumpishmutablenonconformistnondurablenonpermanentnonstandardnonsymmetricalnonsystematicnonuniformnotionalof two mindsorderlesspassingpatchyperishablepetulantplanlesspluralisticpolysemouspromiscuousquirkyraggedramblingrandomreasonlessrestlessroughrovingscatterbrainedscrappysenselessshapelessshiftingshiftyshort-livedshufflingskepticalsnatchyspasmaticspasmicspasmodicspasticspinelesssporadicspottystaggeringstragglingstragglysystemlesstemperamentaltemporaltemporarythoughtlessticklishtouch-and-gotransienttransitivetransitoryunaccountableunarrangeduncalculatinguncertainunclassifiedunconfirmableuncontrolledunconvincedundecidedundependableundeterminedundirectedundisciplinedundivinableundurableunenduringunequableunequalunevenunfixedunforeseeableungradedunguardedunjoinedunmethodicalunmetricalunorderedunorganizedunorthodoxunpersuadedunpredictableunprovableunreasonableunreasoningunreflectingunregularunreliableunresolvedunrestrainedunrhythmicalunsettledunsortedunstableunstable as waterunstaidunsteadfastunsteadyunsureunsymmetricalunsystematicunthinkingunthoughtfulununiformunverifiablevacillatingvagariousvagrantvaguevariablevariegatedvariformvariousvaryingveeringvicissitudinaryvicissitudinousvolatilewanderingwantonwaveringwaverywavywaywardwhimsicalwishy-washywobblingwobbly

No Items Found.

Add Comment
Type in a Nick Name here
 
Related Search Terms
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote

is backupper a word?
anytrans
Random CSS Property

animation-direction

The animation-direction CSS property sets whether an animation should play forward, backward, or alternate back and forth between playing the sequence forward and backward.
animation-direction css reference