Calm

calm

Word Type
n.
calm Meaning Definition
Freedom from motion, agitation, or disturbance; a cessation or absence of that which causes motion or disturbance, as of winds or waves; tranquility; stillness; quiet; serenity.
Synonyms for calm
Synonym Search Links for calm
abnegationabstinenceaccordanceallayalleviateanticycloneappeaseassuageat peaceat restawelessbalmbalmybecalmblankblankmindedbloodlesscalm downcalmnessceasecloisteredcollectedcomposecomposedcomposureconciliateconcordantconservatismconsistencyconsonanceconstancyconstraintcontinencecontinuitycontrolcoolcool offcoolheadedcoolnesscorrespondencecradledead calmdeathlike calmdefusedie downdispassiondispassionatedoldrumsdulcifydwindledwindlingeaseeasyeasygoingebbebbingemptyempty-headedequabilityequableequanimityequilibriumeveneven outeven-temperedeven-tenoredevennessexpectedexpectingfatuousfirmflat calmgentlegentlenessgolden meanhalcyonhalthappy mediumhomogeneityhorse latitudeshushhushedidyllicimpartialityimpassiveimperturbableinactiveinaneincogitantinexcitableisolatedjudiciousnessjuste-milieulaylay the dustlenitylevelheadedlullmake one easymeden aganmiddle waymildmildnessmitigatemoderatenessmoderationmoderationismmoldermolderingmollifymonolithismmotionlessnervelessneutralitynirvanicnonchalantnonviolencenothing in excessobliviousoily calmorderlypacificpacifismpacifypassivepastoralpeacepeaceablepeacefulpeacefulnesspeacetimepersistencephilosophicalphlegmaticpipingplacateplacidplacidityplacidnesspoisedpossessedpour balm intopour balm onpropitiateprudencequellquiescequiescentquietquietenquietisticrelaxrelaxedrelievereposereposefulreposingrestrestfulrestingrestraintrockrock to sleeprock-steadysang-froidsecludedsedateself-abnegationself-controlself-controlledself-denialself-possessedself-possessionself-restraintsequesteredsequestratedsereneserenitysettleshelteredsmoothsmooth downsmooth oversmoothensobrietysoftsoothesootherstabilitystabilizestablestaidstaunchsteadfastnesssteadinesssteadysteady-handedsteady-nervedsteel-nervedstillstill as deathstillishstillnessstillystoicstoicalstolidstopstrong-nervedsubduesubsidesubsidingtemperancetemperatenessthoughtfreethoughtlesstogethertranquiltranquilizetranquillityunagitatedunamazedunastonishedunastoundedunawedunbewilderedunblenchingunblinkingundazedundazzledundisturbedundumbfoundedunexcessivenessunextravaganceunextremenessunfalteringunflappableunflinchingunideaeduniformityunimpressedunintellectualunityunmarvelingunmovedunnervousunoccupiedunperturbedunquiveringunreasoningunruffledunrufflednessunshakenunshakyunshrinkingunstirringunstrainedunsurprisedunthinkinguntremulousuntroubledunwaveringunwonderingvacantvacuousvia mediawanewaningwindlesswindlessnesswithout a tremorwonderless

No Items Found.

Add Comment
Type in a Nick Name here
 
Other Items in n.
Bantling Rotchet Economist Lithographer Accompanier Angelology Cornice Gloaming Experimentation Solomon Tete-a-tete Grogshop Disaffection Oxygenation Dynamitard Judaism Cavendish String Pendice Gnomon Bachelordom Engagement Predella Antiquation Fabliau Subscriber Parabola Stem Auriscope Forecastle Artillery Apostleship Ratifier Brawn Anaesthetization Oriflamme Bankrupt Long-sufferance Fault-finder Pawnbroker Nickname Didactics Archery Exciseman Hereditability Moppet Demission Sans-culottism Maxilla True-penny
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote


Not Sure
Random CSS Property

animation-direction

The animation-direction CSS property sets whether an animation should play forward, backward, or alternate back and forth between playing the sequence forward and backward.
animation-direction css reference