Settle

settle

Word Type
n.
settle Meaning Definition
A seat of any kind.
Synonyms for settle
Synonym Search Links for settle
KOabalienateabideaccommodateaccommodate withaccordadaptadapt toadjustadjust toaffirmafford proof ofagree onagree withalienalienatealightalight uponallayamortizeanchoransweranswer conclusivelyappointargue downarrangearrange mattersascertainassignassimilate toassureattend tobalancebarterbe guided bybeatbeat all hollowbeat hollowbecalmbedbendbequeathbestbillet atbivouacblastblot outbring home tobring to termsbring togetherbump offburrowcalmcalm downcampcavecave incedecertifychartchime in withchoosecinchclarifyclassifyclean upclearclear offclear upclimb downclinchcloseclose withcodifycolonizecome downcome down oncome to anchorcomplycomply withcomposecompoundcompromiseconcertconcludeconferconfirmconformconfoundconfuteconsigncontradictcontrovertconveycookcoordinatecop outcorrectcorrespondcroakcrushdecidedeclinedeeddeed overdeep-dyedefeatdefinedeliverdemisedemolishdemonstratedenizendenydescenddescend upondestroydeterminedevolve upondischargedisciplinedishdismissdismiss all doubtdismountdisposedispose ofdivedo fordo indomesticatedroopdropdrop anchordrop ondrubduck responsibilitydwellembedempeopleenfeoffengraftengraveensconceensureentrencheraseestablishestablish residenceetchevade responsibilityexchangefallfall in withfall onfigurefindfind outfinishfitfixfix onfix upfloorflopflop downflumpflump downfollowfollow fromfoundfoundergear togetget atget downget offgivegive and takegive it togive the businessgive title togive waygo bygo downgo fifty-fiftygravitategroundgun downhandhand downhand onhand overharmonizehave a caseheadheal the breachhidehithit uponhivehold goodhold waterhonorhors de combaticeimpactimplantimpressimprintinclineinfixingraininhabitinscribeinstallinsurejamkeep houseknock outlambastelandlapselatherlaylay outleadleanlickliftlightlight uponliquidatelivelive atlocatelodgelose altitudelowerlullmake a dealmake a decisionmake accounts squaremake an adjustmentmake certainmake concessionsmake conformmake goodmake no doubtmake no mistakemake outmake overmake peacemake suremake sure ofmake upmediatemeetmeet halfwaymethodizemoldmoormovenail downnegotiatenestnonplusnormalizenose-diveobserveofforderorganizeoutclassoutdooutfightoutgeneraloutmaneuveroutpointoutrunoutsailoutshineoverthrowoverturnoverwhelmpackparkparrypasspass onpass overpatch things uppatch uppaypay in fullpay offpay outpay the billpay the shotpay uppeopleperchpickpioneerplaceplanplantplay politicsplopplop downplumpplungepointpolish offpopulateprecipitateprintproveprove to beprove truepurposeputput downput in tuneput to silencequietquiet downquietenquitrationalizereach a compromisereassurerebutreconcilerectifyredeemreduce to silencerefuteregularizeregulaterelaxrelocateremainremove all doubtresideresolverestore harmonyretirereuniteroostrootroutinizerub off cornersrub outruinrulesagsatisfyscuttlesealseatsee thatsee to itselectsellserve one outsetset at restset downset inset to rightsset up housekeepingset up shopsettle differencessettle downsettle insettle onsettle the mattersettle the scoresettle withshapeshoot downshowshut upsign awaysign oversilencesinksink downsitsit downskinskin aliveslouchslumpslump downsmash all oppositionsmooth it oversoothesort outsplit the differencesquaresquare accountssquashsquatsquelchstampstandstandardizestaystay atstereotypestickstillstraightenstraighten outstrike a balancestrike a bargainstrike rootstrike uponsubmergesubsidesubvertsuitsurrenderswagsynchronizesystematizetake a resolutiontake care oftake residence attake roottake the meantake uptake up residencetally withtendtend to gothrashtorpedotouch downtradetranquilizetransfertransmittrimtriumph overtrouncetunetune upturn overundermineundounhorseupsetwastewedgewhipwillwind upwipe outwork outworstyieldzap

No Items Found.

Add Comment
Type in a Nick Name here
 
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote


Me
Random CSS Property

@keyframes

The @keyframes CSS at-rule controls the intermediate steps in a CSS animation sequence by defining styles for keyframes (or waypoints) along the animation sequence. This gives more control over the intermediate steps of the animation sequence than transitions.
@keyframes css reference