Cunning

cunning

Word Type
a.
cunning Meaning Definition
Knowing; skillful; dexterous.
Synonyms for cunning
Synonym Search Links for cunning
ByzantineDaedalianMachiavellianMachiavellianismMachiavellicabilityacuteaddressadeptadeptnessadroitadroitnessagilityairmanshipambidexterityambidextrousanimal cunningaptarchartartfulartfulnessartificeartisanshipartisticartistryastuteauthoritativebad faithbravurabrilliancebrilliantcageycageynesscalculatingcanninesscannycapabilitycapacitychiselingcleancleverclevernesscollusivecommandcompetencecontrolcoordinatedcoordinationcovinouscrackcrackerjackcraftcraftinesscraftsmanshipcraftycrookedcunningnesscutedaedaldaintydeceitdeceitfuldeceitfulnessdeepdeep-laiddeftdeftnessdelicatedesigningdeviousdeviousnessdexteritydexterousdexterousnessdextrousdextrousnessdiplomacydiplomaticdishonestdishonestydissemblancedissimulationdoubledouble-dealingdouble-faceddouble-mindeddouble-tongueddoublehearteddoublenessdoubleness of heartduplicitousduplicityefficiencyexcellentexpertexpertiseexpertnessfacilityfaithlessfaithlessnessfalsefalse-principledfalseheartedfalseheartednessfalsenessfancyfelinefinaglingfinessefoxinessfoxyfraudulentfurtivefurtivenessgoodgoodishgracegracefulgripguileguilefulguilefulnesshandinesshandyhorsemanshiphypocrisyimprobityindirectindirectioningeniousingeniousnessingenuityinsidiousinsidiousnessinventivekeenknow-howknowinglow cunningmagisterialmarksmanshipmasterfulmasterlymastershipmasterymignonneatno meanpawkinesspawkyperfidiouspoliticpractical abilityprofessionalproficiencyproficientprowessquickquicknessquite somereadinessreadyresourceresourcefulresourcefulnesssatanic cunningsavoir-fairesavvyschemingseamanshipserpentinesharpsharpnessshiftinessshiftyshrewdshrewdnessskillskillfulskillfulnessslickslicknessslimslipperyslyslynesssmartsmoothsnakysneak attacksneakinesssneakysomesophisticalstatesmanlikestealthystrategicstylestylishsubtilesubtilitysubtiltysubtlesubtletysupplesurreptitioussurreptitiousnesstacttactfultactfulnesstacticaltechnical brilliancetechnical masterytechnical skilltechniquethe compleatthe completetimingtreacheroustreacherousnesstreacherytrickinesstrickishtricksytrickytwo-facedtwo-facednessunderhandunderhandedunderhandednessvirtuosityvirtuosovulpinewarywell-consideredwell-contrivedwell-designedwell-devisedwell-donewell-inventedwell-laidwell-plannedwell-reasonedwell-thought-outwell-weighedwilewilinesswilywitwizardryworkmanlikeworkmanship

No Items Found.

Add Comment
Type in a Nick Name here
 
Other Items in a.
Unguentous Yellow-eyed Free-spoken Conducive Algific Lubricant High-mettled Extraterritorial Nestorian Connate Congregational Knee-high Whiskered Puerile Reformative Indagative Rewardful Putrescible Bicentenary Conspecific Didactical Untruthful Hummocky Inhuman Easterly Frizzly Disloyal Architectonic Predatory Fifteen Earless Luculent Pelagic Subordinate High-church Automatous Sempervirent Anaemia Divisional Well-natured Tricennial Miasmatic Undermanned Hypodermic Fasciculated Bellied Cursive Errable Semilunate Adjuratory
Other Categories in Words
# /. 3d pers. sing. pres. compar. compar. & superl. wa indic. present l. catechunenus, gr. obs sing. pres. ind. superl. a a & adv. a. a. & a. pron. a. & adv. a. & n. a. & pron. a. . a. / a. pron. a. / adv. a. vigorously a. or pron. a. superl. a., adv., & n. a/ adj. ads. adv. adv. & a. adv. & conj. adv. & n. adv. & prep. adv. / a. adv. / conj. adv. / interj. adv., & n. adv., prep., & conj. b. comp. compar. conj. conj. / adv. dat. & obj. e. i. fem. imp. imp. & p. p. imp. & p. p. adored imp. & p. p. fenced imp. & p. p., imp. & pp. imp. &. p. p. imp. / p. p. imp. p. p. imp., p. p., & a. imperative sing. inf. interj. interj. & adv. interj. & n. interj., adv., & n. n n . n. n. & a. n. & adv. n. & interj. n. & v n. & v. n. & v. i. n. & v. t. n. . n. / interj. n. collect. & pl. n. f. n. fem. n. i. n. masc. n. pl. n. sing & pl. n. sing. n. sing. & pl. n. t. n.. n./ n.masc. n.p. n.pl. n.sing. & pl. obj. p pr. & vb. n. p. & a. p. a. p. p. p. p. & a p. p. & a. p. p. / a. p. p., fem. p. pr & vb. n. p. pr. p. pr. & pr. & vb. n p. pr. & vb n. p. pr. & vb. p. pr. & vb. a. p. pr. & vb. e. p. pr. & vb. n p. pr. & vb. n. p. pr. & vb/ n. p. pr. & vvb. n. p. pr. &. vb. n. p. pr. &vb. n. p. pr.& vb. n. p.a. p]. pr. & vb. n. pl. pref. prep. pron. pron. & a. pron. & conj. pron. / adj. pron. pl. pron., a., conj., & q. superl superl. superl. - supperl. v. v. & a. v. & n. v. i. v. i. & auxiliary. v. i. & i. v. i. & n. v. i. & t. v. i. / auxiliary v. t. v. t. & i. v. t. & n. v. t. & v. i. v. t.& i. v./. v.t
Search Words
Search Words by entering your search text above.
Welcome

This is my test area for webdev. I keep a collection of code here, mostly for my reference. Also if i find a good link, i usually add it here and then forget about it. more...

Subscribe to weekly updates about things i have added to the site or thought interesting during the last week.

You could also follow me on twitter or not... does anyone even use twitter anymore?

If you found something useful or like my work, you can buy me a coffee here. Mmm Coffee. ☕

❤️👩‍💻🎮

🪦 2000 - 16 Oct 2022 - Boots
Random Quote
You want to be the best, you MUST put the long yards in! Nothing comes easy in life so stop wishing and start DOING! So many people would rather bitch and moan than help themselves. Dont be one of those negative drainers, start today, make a small change and keep going forwards with this attitude!
Unknown
Random CSS Property

animation-direction

The animation-direction CSS property sets whether an animation should play forward, backward, or alternate back and forth between playing the sequence forward and backward.
animation-direction css reference